SCOPe 2.06: Domain d2aqca1: 2aqc A:1-60

Lineage for d2aqca1 (2aqc A:1-60)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family)
   automatically mapped to Pfam PF04135

5. Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (3 proteins)
   Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit (75204)

6. Protein Ribosome biogenesis protein Nop10 [144214] (2 species)

7. Species Methanococcus jannaschii [TaxId:2190] [144216] (2 PDB entries)
   Uniprot P81303 1-60

8. Domain d2aqca1: 2aqc A:1-60 [127177]
   Other proteins in same PDB: d2aqca2
   complexed with zn

Details for d2aqca1

PDB Entry: 2aqc

PDB Description: nmr structural analysis of archaeal nop10

PDB Compounds: (A:) Ribosome biogenesis protein Nop10

SCOPe Domain Sequences for d2aqca1:

Sequence; same for both SEQRES and ATOM records:

>d2aqca1 g.41.16.1 (A:1-60) Ribosome biogenesis protein Nop10 {Methanococcus jannaschii [TaxId: 2190]}
mvemrmkkcpkcglytlkeicpkcgektvipkppkfsledrwgkyrrmlkralknknkae

Timeline for d2aqca1:

• d2aqca1 first appeared in SCOP 1.73
  
• d2aqca1 appears in SCOPe 2.05
  
• d2aqca1 appears in SCOPe 2.07
  
• d2aqca1 appears in the current release, SCOPe 2.08