Lineage for d2aqbc2 (2aqb C:254-404)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2523779Family c.95.1.1: Thiolase-related [53902] (10 proteins)
  6. 2523800Protein Beta-ketoacyl-ACP synthase I [53907] (2 species)
  7. 2523801Species Escherichia coli [TaxId:562] [53908] (19 PDB entries)
    Uniprot P14926
  8. 2523935Domain d2aqbc2: 2aqb C:254-404 [127174]
    automated match to d1fj4a2
    complexed with tl6

Details for d2aqbc2

PDB Entry: 2aqb (more details), 2.19 Å

PDB Description: structure-activity relationships at the 5-position of thiolactomycin: an intact 5(r)-isoprene unit is required for activity against the condensing enzymes from mycobacterium tuberculosis and escherchia coli
PDB Compounds: (C:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d2aqbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aqbc2 c.95.1.1 (C:254-404) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrkl

SCOPe Domain Coordinates for d2aqbc2:

Click to download the PDB-style file with coordinates for d2aqbc2.
(The format of our PDB-style files is described here.)

Timeline for d2aqbc2: