![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.1: Thiolase-related [53902] (20 proteins) |
![]() | Protein Beta-ketoacyl-ACP synthase I, C-terminal domain [419015] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [419487] (19 PDB entries) Uniprot P14926 |
![]() | Domain d2aqbc2: 2aqb C:254-404 [127174] Other proteins in same PDB: d2aqba1, d2aqbb1, d2aqbc1, d2aqbd1 automated match to d1fj4a2 complexed with tl6 |
PDB Entry: 2aqb (more details), 2.19 Å
SCOPe Domain Sequences for d2aqbc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aqbc2 c.95.1.1 (C:254-404) Beta-ketoacyl-ACP synthase I, C-terminal domain {Escherichia coli [TaxId: 562]} yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni vtettdrelttvmsnsfgfggtnatlvmrkl
Timeline for d2aqbc2: