Lineage for d2aqbb2 (2aqb B:254-404)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 711303Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 711304Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 711305Family c.95.1.1: Thiolase-related [53902] (8 proteins)
  6. 711326Protein Beta-ketoacyl-ACP synthase I [53907] (1 species)
  7. 711327Species Escherichia coli [TaxId:562] [53908] (19 PDB entries)
  8. 711411Domain d2aqbb2: 2aqb B:254-404 [127172]
    automatically matched to d1h4fa2
    complexed with tl6

Details for d2aqbb2

PDB Entry: 2aqb (more details), 2.19 Å

PDB Description: structure-activity relationships at the 5-position of thiolactomycin: an intact 5(r)-isoprene unit is required for activity against the condensing enzymes from mycobacterium tuberculosis and escherchia coli
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOP Domain Sequences for d2aqbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aqbb2 c.95.1.1 (B:254-404) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrkl

SCOP Domain Coordinates for d2aqbb2:

Click to download the PDB-style file with coordinates for d2aqbb2.
(The format of our PDB-style files is described here.)

Timeline for d2aqbb2: