SCOPe 2.03: Domain d2aqbb1: 2aqb B:2-253

Lineage for d2aqbb1 (2aqb B:2-253)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (9 proteins)

6. Protein Beta-ketoacyl-ACP synthase I [53907] (1 species)

7. Species Escherichia coli [TaxId:562] [53908] (23 PDB entries)
   Uniprot P14926

8. Domain d2aqbb1: 2aqb B:2-253 [127171]
   automated match to d1fj4a1
   complexed with tl6

Details for d2aqbb1

PDB Entry: 2aqb, 2.19 Å

PDB Description: structure-activity relationships at the 5-position of thiolactomycin: an intact 5(r)-isoprene unit is required for activity against the condensing enzymes from mycobacterium tuberculosis and escherchia coli

PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d2aqbb1:

Sequence; same for both SEQRES and ATOM records:

>d2aqbb1 c.95.1.1 (B:2-253) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]}
kravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttglid
rkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadamr
gprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlgk
qdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvve
elehalargahi

Timeline for d2aqbb1:

• d2aqbb1 first appeared in SCOP 1.73
  
• d2aqbb1 appears in SCOPe 2.02
  
• d2aqbb1 appears in SCOPe 2.04
  
• d2aqbb1 appears in the current release, SCOPe 2.08