Lineage for d2aqaa1 (2aqa A:2-58)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 751344Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family) (S)
  5. 751345Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (2 proteins)
    Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit (75204)
  6. 751346Protein H/aca ribonucleoprotein complex subunit 3 [144212] (1 species)
    lacks the zinc-binding site, mostly unstructured
  7. 751347Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [144213] (2 PDB entries)
  8. 751348Domain d2aqaa1: 2aqa A:2-58 [127168]

Details for d2aqaa1

PDB Entry: 2aqa (more details)

PDB Description: nmr structural analysis of nop10p from saccharomyces cerevisiae
PDB Compounds: (A:) H/ACA ribonucleoprotein complex subunit 3

SCOP Domain Sequences for d2aqaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aqaa1 g.41.16.1 (A:2-58) H/aca ribonucleoprotein complex subunit 3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hlmytlgpdgkriytlkkvtesgeitksahparfspddkysrqrvtlkkrfglvpgq

SCOP Domain Coordinates for d2aqaa1:

Click to download the PDB-style file with coordinates for d2aqaa1.
(The format of our PDB-style files is described here.)

Timeline for d2aqaa1: