Lineage for d2aq9a1 (2aq9 A:1-262)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809516Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 809517Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (8 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 809518Family b.81.1.1: UDP N-acetylglucosamine acyltransferase [51162] (1 protein)
    this is a repeat family; one repeat unit is 2jf2 A:59-89 found in domain
  6. 809519Protein UDP N-acetylglucosamine acyltransferase [51163] (2 species)
  7. 809520Species Escherichia coli, gene lpxA [TaxId:562] [51164] (6 PDB entries)
  8. 809523Domain d2aq9a1: 2aq9 A:1-262 [127167]
    automatically matched to d1lxa__
    complexed with dms, po4

Details for d2aq9a1

PDB Entry: 2aq9 (more details), 1.8 Å

PDB Description: Structure of E. coli LpxA with a bound peptide that is competitive with acyl-ACP
PDB Compounds: (A:) acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase

SCOP Domain Sequences for d2aq9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aq9a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]}
midksafvhptaiveegasiganahigpfcivgphveigegtvlkshvvvnghtkigrdn
eiyqfasigevnqdlkyageptrveigdrnriresvtihrgtvqgggltkvgsdnllmin
ahiahdctvgnrcilannatlaghvsvddfaiiggmtavhqfciigahvmvggcsgvaqd
vppyviaqgnhatpfgvnieglkrrgfsreaitairnaykliyrsgktldevkpeiaela
etypevkaftdffarstrglir

SCOP Domain Coordinates for d2aq9a1:

Click to download the PDB-style file with coordinates for d2aq9a1.
(The format of our PDB-style files is described here.)

Timeline for d2aq9a1: