Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein Enoyl-ACP reductase [51791] (6 species) |
Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (24 PDB entries) |
Domain d2aq8a1: 2aq8 A:3-269 [127166] automatically matched to d1bvra_ complexed with lys, nad |
PDB Entry: 2aq8 (more details), 1.92 Å
SCOP Domain Sequences for d2aq8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aq8a1 c.2.1.2 (A:3-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} glldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakaplle ldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihi saysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagky gvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvaktv callsdwlpattgdiiyadggahtqll
Timeline for d2aq8a1: