SCOP 1.73: Domain d2aq7c1: 2aq7 C:2-253

Lineage for d2aq7c1 (2aq7 C:2-253)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.1: Thiolase-related [53902] (8 proteins)

6. Protein Beta-ketoacyl-ACP synthase I [53907] (1 species)

7. Species Escherichia coli [TaxId:562] [53908] (19 PDB entries)

8. Domain d2aq7c1: 2aq7 C:2-253 [127162]
   automatically matched to d1h4fa1
   complexed with tl5

Details for d2aq7c1

PDB Entry: 2aq7, 2.3 Å

PDB Description: Structure-activity relationships at the 5-posiiton of thiolactomycin: an intact 5(R)-isoprene unit is required for activity against the condensing enzymes from Mycobacterium tuberculosis and Escherichia coli

PDB Compounds: (C:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOP Domain Sequences for d2aq7c1:

Sequence; same for both SEQRES and ATOM records:

>d2aq7c1 c.95.1.1 (C:2-253) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]}
kravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttglid
rkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadamr
gprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlgk
qdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvve
elehalargahi

Timeline for d2aq7c1:

• d2aq7c1 is new in SCOP 1.73
  
• d2aq7c1 appears in SCOP 1.75
  
• d2aq7c1 appears in the current release, SCOPe 2.08