Lineage for d2aq7b2 (2aq7 B:254-404)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1392123Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1392124Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1392125Family c.95.1.1: Thiolase-related [53902] (9 proteins)
  6. 1392146Protein Beta-ketoacyl-ACP synthase I [53907] (1 species)
  7. 1392147Species Escherichia coli [TaxId:562] [53908] (23 PDB entries)
    Uniprot P14926
  8. 1392279Domain d2aq7b2: 2aq7 B:254-404 [127161]
    automated match to d1fj4a2
    complexed with tl5

Details for d2aq7b2

PDB Entry: 2aq7 (more details), 2.3 Å

PDB Description: Structure-activity relationships at the 5-posiiton of thiolactomycin: an intact 5(R)-isoprene unit is required for activity against the condensing enzymes from Mycobacterium tuberculosis and Escherichia coli
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d2aq7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aq7b2 c.95.1.1 (B:254-404) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrkl

SCOPe Domain Coordinates for d2aq7b2:

Click to download the PDB-style file with coordinates for d2aq7b2.
(The format of our PDB-style files is described here.)

Timeline for d2aq7b2: