Lineage for d2aq6b_ (2aq6 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2063731Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2063732Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2063733Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. 2063789Protein Hypothetical protein Rv1155 [117230] (1 species)
  7. 2063790Species Mycobacterium tuberculosis [TaxId:1773] [117231] (4 PDB entries)
    Uniprot O06553
  8. 2063794Domain d2aq6b_: 2aq6 B: [127157]
    automated match to d1w9ab_
    complexed with plp

Details for d2aq6b_

PDB Entry: 2aq6 (more details), 1.7 Å

PDB Description: X-ray crystal structure of mycobacterium tuberculosis pyridoxine 5'-phosphate oxidase complexed with pyridoxal 5'-phosphate at 1.7 a resolution
PDB Compounds: (B:) pyridoxine 5'-phosphate oxidase

SCOPe Domain Sequences for d2aq6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aq6b_ b.45.1.1 (B:) Hypothetical protein Rv1155 {Mycobacterium tuberculosis [TaxId: 1773]}
vfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrnlrrd
prasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddyrqam
vtdrrvlltlpishvyglppgmr

SCOPe Domain Coordinates for d2aq6b_:

Click to download the PDB-style file with coordinates for d2aq6b_.
(The format of our PDB-style files is described here.)

Timeline for d2aq6b_: