Lineage for d2aq6b1 (2aq6 B:5-147)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669990Fold b.45: Split barrel-like [50474] (2 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 669991Superfamily b.45.1: FMN-binding split barrel [50475] (3 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 669992Family b.45.1.1: PNP-oxidase like [50476] (16 proteins)
  6. 670037Protein Hypothetical protein Rv1155 [117230] (1 species)
  7. 670038Species Mycobacterium tuberculosis [TaxId:1773] [117231] (4 PDB entries)
  8. 670042Domain d2aq6b1: 2aq6 B:5-147 [127157]
    automatically matched to 1Y30 A:5-147
    complexed with plp

Details for d2aq6b1

PDB Entry: 2aq6 (more details), 1.7 Å

PDB Description: X-ray crystal structure of mycobacterium tuberculosis pyridoxine 5'-phosphate oxidase complexed with pyridoxal 5'-phosphate at 1.7 a resolution
PDB Compounds: (B:) pyridoxine 5'-phosphate oxidase

SCOP Domain Sequences for d2aq6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aq6b1 b.45.1.1 (B:5-147) Hypothetical protein Rv1155 {Mycobacterium tuberculosis [TaxId: 1773]}
vfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrnlrrd
prasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddyrqam
vtdrrvlltlpishvyglppgmr

SCOP Domain Coordinates for d2aq6b1:

Click to download the PDB-style file with coordinates for d2aq6b1.
(The format of our PDB-style files is described here.)

Timeline for d2aq6b1: