SCOP 1.73: Domain d2aq6a1: 2aq6 A:5-147

Lineage for d2aq6a1 (2aq6 A:5-147)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.45: Split barrel-like [50474] (2 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (3 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (16 proteins)

6. Protein Hypothetical protein Rv1155 [117230] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [117231] (4 PDB entries)

8. Domain d2aq6a1: 2aq6 A:5-147 [127156]
   automatically matched to 1Y30 A:5-147
   complexed with plp

Details for d2aq6a1

PDB Entry: 2aq6, 1.7 Å

PDB Description: X-ray crystal structure of mycobacterium tuberculosis pyridoxine 5'-phosphate oxidase complexed with pyridoxal 5'-phosphate at 1.7 a resolution

PDB Compounds: (A:) pyridoxine 5'-phosphate oxidase

SCOP Domain Sequences for d2aq6a1:

Sequence; same for both SEQRES and ATOM records:

>d2aq6a1 b.45.1.1 (A:5-147) Hypothetical protein Rv1155 {Mycobacterium tuberculosis [TaxId: 1773]}
vfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrnlrrd
prasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddyrqam
vtdrrvlltlpishvyglppgmr

Timeline for d2aq6a1:

• d2aq6a1 is new in SCOP 1.73
  
• d2aq6a1 appears in SCOP 1.75
  
• d2aq6a1 appears in the current release, SCOPe 2.08, called d2aq6a_