SCOPe 2.08: Domain d2aq6a_: 2aq6 A:

Lineage for d2aq6a_ (2aq6 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)

6. Protein Hypothetical protein Rv1155 [117230] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [117231] (4 PDB entries)
   Uniprot O06553

8. Domain d2aq6a_: 2aq6 A: [127156]
   automated match to d1w9ab_
   complexed with plp

Details for d2aq6a_

PDB Entry: 2aq6, 1.7 Å

PDB Description: X-ray crystal structure of mycobacterium tuberculosis pyridoxine 5'-phosphate oxidase complexed with pyridoxal 5'-phosphate at 1.7 a resolution

PDB Compounds: (A:) pyridoxine 5'-phosphate oxidase

SCOPe Domain Sequences for d2aq6a_:

Sequence; same for both SEQRES and ATOM records:

>d2aq6a_ b.45.1.1 (A:) Hypothetical protein Rv1155 {Mycobacterium tuberculosis [TaxId: 1773]}
vfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrnlrrd
prasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddyrqam
vtdrrvlltlpishvyglppgmr

Timeline for d2aq6a_:

• d2aq6a_ first appeared in SCOP 1.73, called d2aq6a1
  
• d2aq6a_ appears in SCOPe 2.07