![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
![]() | Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [54345] (20 PDB entries) Uniprot P23313 |
![]() | Domain d2aq3h2: 2aq3 H:119-237 [127155] Other proteins in same PDB: d2aq3a1, d2aq3b1, d2aq3c_, d2aq3d1, d2aq3e_, d2aq3f1, d2aq3g_, d2aq3h1 automated match to d3bvga2 |
PDB Entry: 2aq3 (more details), 2.3 Å
SCOPe Domain Sequences for d2aq3h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aq3h2 d.15.6.1 (H:119-237) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]} nhfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
Timeline for d2aq3h2: