SCOPe 2.06: Domain d2aq3h1: 2aq3 H:1-118

Lineage for d2aq3h1 (2aq3 H:1-118)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50229] (20 PDB entries)
   Uniprot P23313

8. Domain d2aq3h1: 2aq3 H:1-118 [127154]
   Other proteins in same PDB: d2aq3a1, d2aq3b2, d2aq3c_, d2aq3d2, d2aq3e_, d2aq3f2, d2aq3g_, d2aq3h2
   automated match to d3bvza1

Details for d2aq3h1

PDB Entry: 2aq3, 2.3 Å

PDB Description: Crystal structure of T-cell receptor V beta domain variant complexed with superantigen SEC3

PDB Compounds: (H:) Enterotoxin type C-3

SCOPe Domain Sequences for d2aq3h1:

Sequence; same for both SEQRES and ATOM records:

>d2aq3h1 b.40.2.2 (H:1-118) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdgkvtggktcmyggitkheg

Timeline for d2aq3h1:

• d2aq3h1 first appeared in SCOP 1.73
  
• d2aq3h1 appears in SCOPe 2.05
  
• d2aq3h1 appears in SCOPe 2.07
  
• d2aq3h1 appears in the current release, SCOPe 2.08