| Class b: All beta proteins [48724] (176 folds) |
| Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
| Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins) |
| Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [50229] (20 PDB entries) Uniprot P23313 |
| Domain d2aq3h1: 2aq3 H:1-118 [127154] Other proteins in same PDB: d2aq3a1, d2aq3b2, d2aq3c_, d2aq3d2, d2aq3e_, d2aq3f2, d2aq3g_, d2aq3h2 automated match to d3bvza1 |
PDB Entry: 2aq3 (more details), 2.3 Å
SCOPe Domain Sequences for d2aq3h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aq3h1 b.40.2.2 (H:1-118) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdgkvtggktcmyggitkheg
Timeline for d2aq3h1: