Lineage for d2aq3f2 (2aq3 F:119-237)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179689Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2179690Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2179755Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)
  7. 2179756Species Staphylococcus aureus [TaxId:1280] [54345] (20 PDB entries)
    Uniprot P23313
  8. 2179782Domain d2aq3f2: 2aq3 F:119-237 [127153]
    Other proteins in same PDB: d2aq3a1, d2aq3b1, d2aq3c_, d2aq3d1, d2aq3e_, d2aq3f1, d2aq3g_, d2aq3h1
    automated match to d3bvga2

Details for d2aq3f2

PDB Entry: 2aq3 (more details), 2.3 Å

PDB Description: Crystal structure of T-cell receptor V beta domain variant complexed with superantigen SEC3
PDB Compounds: (F:) Enterotoxin type C-3

SCOPe Domain Sequences for d2aq3f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aq3f2 d.15.6.1 (F:119-237) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
nhfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng

SCOPe Domain Coordinates for d2aq3f2:

Click to download the PDB-style file with coordinates for d2aq3f2.
(The format of our PDB-style files is described here.)

Timeline for d2aq3f2: