Lineage for d2aq3f1 (2aq3 F:2-119)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 667366Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 667804Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)
  6. 667931Protein Streptococcal superantigen SSA [50238] (1 species)
  7. 667932Species Streptococcus pyogenes [TaxId:1314] [50239] (4 PDB entries)
  8. 667942Domain d2aq3f1: 2aq3 F:2-119 [127152]
    Other proteins in same PDB: d2aq3b2, d2aq3d2, d2aq3f2, d2aq3h2
    automatically matched to d1bxta1
    mutant

Details for d2aq3f1

PDB Entry: 2aq3 (more details), 2.3 Å

PDB Description: Crystal structure of T-cell receptor V beta domain variant complexed with superantigen SEC3
PDB Compounds: (F:) Enterotoxin type C-3

SCOP Domain Sequences for d2aq3f1:

Sequence, based on SEQRES records: (download)

>d2aq3f1 b.40.2.2 (F:2-119) Streptococcal superantigen SSA {Streptococcus pyogenes [TaxId: 1314]}
sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny
dkvktellnedlakkykdevvdvygsnyyvncyfsskdgkvtggktcmyggitkhegn

Sequence, based on observed residues (ATOM records): (download)

>d2aq3f1 b.40.2.2 (F:2-119) Streptococcal superantigen SSA {Streptococcus pyogenes [TaxId: 1314]}
sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny
dkvktellnedlakkykdevvdvygsnyyvncyfsskdtggktcmyggitkhegn

SCOP Domain Coordinates for d2aq3f1:

Click to download the PDB-style file with coordinates for d2aq3f1.
(The format of our PDB-style files is described here.)

Timeline for d2aq3f1: