SCOPe 2.07: Domain d2aq3d2: 2aq3 D:119-237

Lineage for d2aq3d2 (2aq3 D:119-237)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54345] (20 PDB entries)
   Uniprot P23313

8. Domain d2aq3d2: 2aq3 D:119-237 [127151]
   Other proteins in same PDB: d2aq3a1, d2aq3b1, d2aq3c_, d2aq3d1, d2aq3e_, d2aq3f1, d2aq3g_, d2aq3h1
   automated match to d3bvga2

Details for d2aq3d2

PDB Entry: 2aq3, 2.3 Å

PDB Description: Crystal structure of T-cell receptor V beta domain variant complexed with superantigen SEC3

PDB Compounds: (D:) Enterotoxin type C-3

SCOPe Domain Sequences for d2aq3d2:

Sequence; same for both SEQRES and ATOM records:

>d2aq3d2 d.15.6.1 (D:119-237) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
nhfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng

Timeline for d2aq3d2:

• d2aq3d2 first appeared in SCOP 1.73
  
• d2aq3d2 appears in SCOPe 2.06
  
• d2aq3d2 appears in the current release, SCOPe 2.08