Lineage for d2aq3d1 (2aq3 D:2-119)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 949388Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 949887Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (15 proteins)
  6. 950017Protein Streptococcal superantigen SSA [50238] (1 species)
  7. 950018Species Streptococcus pyogenes [TaxId:1314] [50239] (4 PDB entries)
  8. 950027Domain d2aq3d1: 2aq3 D:2-119 [127150]
    Other proteins in same PDB: d2aq3a1, d2aq3b2, d2aq3c_, d2aq3d2, d2aq3e_, d2aq3f2, d2aq3g_, d2aq3h2
    automatically matched to d1bxta1

Details for d2aq3d1

PDB Entry: 2aq3 (more details), 2.3 Å

PDB Description: Crystal structure of T-cell receptor V beta domain variant complexed with superantigen SEC3
PDB Compounds: (D:) Enterotoxin type C-3

SCOPe Domain Sequences for d2aq3d1:

Sequence, based on SEQRES records: (download)

>d2aq3d1 b.40.2.2 (D:2-119) Streptococcal superantigen SSA {Streptococcus pyogenes [TaxId: 1314]}
sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny
dkvktellnedlakkykdevvdvygsnyyvncyfsskdgkvtggktcmyggitkhegn

Sequence, based on observed residues (ATOM records): (download)

>d2aq3d1 b.40.2.2 (D:2-119) Streptococcal superantigen SSA {Streptococcus pyogenes [TaxId: 1314]}
sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny
dkvktellnedlakkykdevvdvygsnyyvncyfsskdkvtggktcmyggitkhegn

SCOPe Domain Coordinates for d2aq3d1:

Click to download the PDB-style file with coordinates for d2aq3d1.
(The format of our PDB-style files is described here.)

Timeline for d2aq3d1: