Lineage for d2aq3b1 (2aq3 B:2-118)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788945Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2789011Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species)
  7. 2789012Species Staphylococcus aureus [TaxId:1280] [50229] (20 PDB entries)
    Uniprot P23313
  8. 2789032Domain d2aq3b1: 2aq3 B:2-118 [127148]
    Other proteins in same PDB: d2aq3a1, d2aq3b2, d2aq3c_, d2aq3d2, d2aq3e_, d2aq3f2, d2aq3g_, d2aq3h2
    automated match to d3bvza1

Details for d2aq3b1

PDB Entry: 2aq3 (more details), 2.3 Å

PDB Description: Crystal structure of T-cell receptor V beta domain variant complexed with superantigen SEC3
PDB Compounds: (B:) Enterotoxin type C-3

SCOPe Domain Sequences for d2aq3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aq3b1 b.40.2.2 (B:2-118) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny
dkvktellnedlakkykdevvdvygsnyyvncyfsskdgkvtggktcmyggitkheg

SCOPe Domain Coordinates for d2aq3b1:

Click to download the PDB-style file with coordinates for d2aq3b1.
(The format of our PDB-style files is described here.)

Timeline for d2aq3b1: