Lineage for d2aq2b2 (2aq2 B:124-235)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1018752Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 1018753Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins)
  6. 1018883Protein Streptococcal superantigen SSA [54354] (1 species)
  7. 1018884Species Streptococcus pyogenes [TaxId:1314] [54355] (4 PDB entries)
  8. 1018885Domain d2aq2b2: 2aq2 B:124-235 [127147]
    Other proteins in same PDB: d2aq2a1, d2aq2b1
    automatically matched to d1bxta2
    complexed with na, so4, zn; mutant

Details for d2aq2b2

PDB Entry: 2aq2 (more details), 1.8 Å

PDB Description: crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3 mutant
PDB Compounds: (B:) Enterotoxin type C-3

SCOPe Domain Sequences for d2aq2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aq2b2 d.15.6.1 (B:124-235) Streptococcal superantigen SSA {Streptococcus pyogenes [TaxId: 1314]}
gnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyetgy
ikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttk

SCOPe Domain Coordinates for d2aq2b2:

Click to download the PDB-style file with coordinates for d2aq2b2.
(The format of our PDB-style files is described here.)

Timeline for d2aq2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aq2b1
View in 3D
Domains from other chains:
(mouse over for more information)
d2aq2a1