Lineage for d2aq2b1 (2aq2 B:2-119)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1313712Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1314261Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 1314402Protein Streptococcal superantigen SSA [50238] (1 species)
  7. 1314403Species Streptococcus pyogenes [TaxId:1314] [50239] (4 PDB entries)
  8. 1314404Domain d2aq2b1: 2aq2 B:2-119 [127146]
    Other proteins in same PDB: d2aq2a1, d2aq2b2
    automatically matched to d1bxta1
    complexed with na, so4, zn; mutant

Details for d2aq2b1

PDB Entry: 2aq2 (more details), 1.8 Å

PDB Description: crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3 mutant
PDB Compounds: (B:) Enterotoxin type C-3

SCOPe Domain Sequences for d2aq2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aq2b1 b.40.2.2 (B:2-119) Streptococcal superantigen SSA {Streptococcus pyogenes [TaxId: 1314]}
sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny
dkvktellnedlakkykdevvdvygsnyyvncyfsskdnvwwpgktcmyggitkhegn

SCOPe Domain Coordinates for d2aq2b1:

Click to download the PDB-style file with coordinates for d2aq2b1.
(The format of our PDB-style files is described here.)

Timeline for d2aq2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aq2b2
View in 3D
Domains from other chains:
(mouse over for more information)
d2aq2a1