![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
![]() | Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [54345] (20 PDB entries) Uniprot P23313 |
![]() | Domain d2aq1h2: 2aq1 H:117-237 [127145] Other proteins in same PDB: d2aq1a_, d2aq1b1, d2aq1c_, d2aq1d1, d2aq1e_, d2aq1f1, d2aq1g_, d2aq1h1 automated match to d3bzdb2 mutant |
PDB Entry: 2aq1 (more details), 2.1 Å
SCOPe Domain Sequences for d2aq1h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aq1h2 d.15.6.1 (H:117-237) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]} egnhfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefns spyetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkn g
Timeline for d2aq1h2: