![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
![]() | Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins) |
![]() | Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [50229] (20 PDB entries) Uniprot P23313 |
![]() | Domain d2aq1h1: 2aq1 H:1-116 [127144] Other proteins in same PDB: d2aq1a_, d2aq1b2, d2aq1c_, d2aq1d2, d2aq1e_, d2aq1f2, d2aq1g_, d2aq1h2 automated match to d3bzdb1 mutant |
PDB Entry: 2aq1 (more details), 2.1 Å
SCOPe Domain Sequences for d2aq1h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aq1h1 b.40.2.2 (H:1-116) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]} esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvwwhgktcmyggitkh
Timeline for d2aq1h1: