SCOP 1.75: Domain d2aq1f2: 2aq1 F:124-235

Lineage for d2aq1f2 (2aq1 F:124-235)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins)

6. Protein Streptococcal superantigen SSA [54354] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [54355] (4 PDB entries)

8. Domain d2aq1f2: 2aq1 F:124-235 [127143]
   Other proteins in same PDB: d2aq1b1, d2aq1d1, d2aq1f1, d2aq1h1
   automatically matched to d1bxta2
   mutant

Details for d2aq1f2

PDB Entry: 2aq1, 2.1 Å

PDB Description: crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3 mutant

PDB Compounds: (F:) Enterotoxin type C-3

SCOP Domain Sequences for d2aq1f2:

Sequence; same for both SEQRES and ATOM records:

>d2aq1f2 d.15.6.1 (F:124-235) Streptococcal superantigen SSA {Streptococcus pyogenes [TaxId: 1314]}
gnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyetgy
ikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttk

Timeline for d2aq1f2:

• d2aq1f2 first appeared in SCOP 1.73
  
• d2aq1f2 appears in SCOPe 2.01
  
• d2aq1f2 appears in the current release, SCOPe 2.08