![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) ![]() |
![]() | Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (15 proteins) |
![]() | Protein Streptococcal superantigen SSA [50238] (1 species) |
![]() | Species Streptococcus pyogenes [TaxId:1314] [50239] (4 PDB entries) |
![]() | Domain d2aq1f1: 2aq1 F:2-119 [127142] Other proteins in same PDB: d2aq1b2, d2aq1d2, d2aq1f2, d2aq1h2 automatically matched to d1bxta1 mutant |
PDB Entry: 2aq1 (more details), 2.1 Å
SCOP Domain Sequences for d2aq1f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aq1f1 b.40.2.2 (F:2-119) Streptococcal superantigen SSA {Streptococcus pyogenes [TaxId: 1314]} sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny dkvktellnedlakkykdevvdvygsnyyvncyfsskdnvwwhgktcmyggitkhegn
Timeline for d2aq1f1: