Lineage for d2aq0b_ (2aq0 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2328799Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 2328855Family a.60.2.5: Hef domain-like [140629] (4 proteins)
    helicase/nuclease domain; forms homo and heterodimers; probably includes the Excinuclease UvrC C-terminal domain ((81795), that contains a single NMR structure of a monomeric truncated domain, 1kft)
  6. 2328865Protein DNA repair endonuclease XPF [140634] (2 species)
  7. 2328873Species Human (Homo sapiens) [TaxId:9606] [140636] (4 PDB entries)
    Uniprot Q92889 823-905! Uniprot Q92889 837-898
  8. 2328877Domain d2aq0b_: 2aq0 B: [127137]
    automated match to d2aq0a1

Details for d2aq0b_

PDB Entry: 2aq0 (more details)

PDB Description: solution structure of the human homodimeric dna repair protein xpf
PDB Compounds: (B:) DNA repair endonuclease XPF

SCOPe Domain Sequences for d2aq0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aq0b_ a.60.2.5 (B:) DNA repair endonuclease XPF {Human (Homo sapiens) [TaxId: 9606]}
mdsetlpesekynpgpqdfllkmpgvnakncrslmhhvkniaelaalsqdeltsilgnaa
nakqlydfihtsfaevvskgkgkk

SCOPe Domain Coordinates for d2aq0b_:

Click to download the PDB-style file with coordinates for d2aq0b_.
(The format of our PDB-style files is described here.)

Timeline for d2aq0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2aq0a_