SCOPe 2.08: Domain d2apla1: 2apl A:2-150

Lineage for d2apla1 (2apl A:2-150)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.258: PG0816-like [140752] (1 superfamily)
   multihelical; comprises two helical bundles, both are topologically similar to the RuvA C-terminal domain-like fold (46928)

4. Superfamily a.258.1: PG0816-like [140753] (1 family)
   automatically mapped to Pfam PF08989

5. Family a.258.1.1: PG0816-like [140754] (1 protein)
   Pfam PF08989; DUF1896

6. Protein Hypothetical protein PG0816 [140755] (1 species)

7. Species Porphyromonas gingivalis [TaxId:837] [140756] (1 PDB entry)
   Uniprot Q7MW33 2-150

8. Domain d2apla1: 2apl A:2-150 [127132]

Details for d2apla1

PDB Entry: 2apl, 2.01 Å

PDB Description: Crystal structure of protein PG0816 from Porphyromonas gingivalis

PDB Compounds: (A:) hypothetical protein PG0816

SCOPe Domain Sequences for d2apla1:

Sequence; same for both SEQRES and ATOM records:

>d2apla1 a.258.1.1 (A:2-150) Hypothetical protein PG0816 {Porphyromonas gingivalis [TaxId: 837]}
kstekkelshfrlkletylnehfpemsgnnpfitarsdealtaycdavaqgfshpeaesm
asevlyqglhfsrydtlvsvlerefeqelpsplperlapillknkaiqsvfakydltddf
easpeyehlyteltgtivlliesnhlpti

Timeline for d2apla1:

• d2apla1 first appeared in SCOP 1.73
  
• d2apla1 appears in SCOPe 2.07