![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.258: PG0816-like [140752] (1 superfamily) multihelical; comprises two helical bundles, both are topologically similar to the RuvA C-terminal domain-like fold (46928) |
![]() | Superfamily a.258.1: PG0816-like [140753] (1 family) ![]() automatically mapped to Pfam PF08989 |
![]() | Family a.258.1.1: PG0816-like [140754] (1 protein) Pfam PF08989; DUF1896 |
![]() | Protein Hypothetical protein PG0816 [140755] (1 species) |
![]() | Species Porphyromonas gingivalis [TaxId:837] [140756] (1 PDB entry) Uniprot Q7MW33 2-150 |
![]() | Domain d2apla1: 2apl A:2-150 [127132] |
PDB Entry: 2apl (more details), 2.01 Å
SCOPe Domain Sequences for d2apla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2apla1 a.258.1.1 (A:2-150) Hypothetical protein PG0816 {Porphyromonas gingivalis [TaxId: 837]} kstekkelshfrlkletylnehfpemsgnnpfitarsdealtaycdavaqgfshpeaesm asevlyqglhfsrydtlvsvlerefeqelpsplperlapillknkaiqsvfakydltddf easpeyehlyteltgtivlliesnhlpti
Timeline for d2apla1: