SCOPe 2.07: Domain d2apjc_: 2apj C:

Lineage for d2apjc_ (2apj C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (10 families)

5. Family c.23.10.7: Putative acetylxylan esterase-like [142058] (3 proteins)
   Pfam PF03629 (DUF303); contains a characteristic zinc(less) finger-like insertion after strand 1; lacks the conserved in other families Asn residue

6. Protein Putative acetylxylan esterase At4g34215 [142059] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142060] (2 PDB entries)
   Uniprot Q8L9J9 17-260

8. Domain d2apjc_: 2apj C: [127130]
   automated match to d2apja1

Details for d2apjc_

PDB Entry: 2apj, 1.6 Å

PDB Description: x-ray structure of protein from arabidopsis thaliana at4g34215 at 1.6 angstrom resolution

PDB Compounds: (C:) Putative Esterase

SCOPe Domain Sequences for d2apjc_:

Sequence; same for both SEQRES and ATOM records:

>d2apjc_ c.23.10.7 (C:) Putative acetylxylan esterase At4g34215 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ppnqifilsgqsnmagrggvfkdhhnnrwvwdkilppecapnssilrlsadlrweeahep
lhvdidtgkvcgvgpgmafanavknrletdsaviglvpcasggtaikewergshlyermv
krteesrkcggeikavlwyqgesdvldihdaesygnnmdrliknlrhdlnlpslpiiqva
iasgggyidkvreaqlglklsnvvcvdakglplksdnlhltteaqvqlglslaqaylsnf
c

Timeline for d2apjc_:

• d2apjc_ first appeared in SCOP 1.73, called d2apjc1
  
• d2apjc_ appears in SCOPe 2.06
  
• d2apjc_ appears in the current release, SCOPe 2.08