![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.10: SGNH hydrolase [52266] (10 families) ![]() |
![]() | Family c.23.10.7: Putative acetylxylan esterase-like [142058] (3 proteins) Pfam PF03629 (DUF303); contains a characteristic zinc(less) finger-like insertion after strand 1; lacks the conserved in other families Asn residue |
![]() | Protein Putative acetylxylan esterase At4g34215 [142059] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142060] (2 PDB entries) Uniprot Q8L9J9 17-260 |
![]() | Domain d2apjc_: 2apj C: [127130] automated match to d2apja1 |
PDB Entry: 2apj (more details), 1.6 Å
SCOPe Domain Sequences for d2apjc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2apjc_ c.23.10.7 (C:) Putative acetylxylan esterase At4g34215 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ppnqifilsgqsnmagrggvfkdhhnnrwvwdkilppecapnssilrlsadlrweeahep lhvdidtgkvcgvgpgmafanavknrletdsaviglvpcasggtaikewergshlyermv krteesrkcggeikavlwyqgesdvldihdaesygnnmdrliknlrhdlnlpslpiiqva iasgggyidkvreaqlglklsnvvcvdakglplksdnlhltteaqvqlglslaqaylsnf c
Timeline for d2apjc_: