Lineage for d2apjc_ (2apj C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857378Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2857465Family c.23.10.7: Putative acetylxylan esterase-like [142058] (3 proteins)
    Pfam PF03629 (DUF303); contains a characteristic zinc(less) finger-like insertion after strand 1; lacks the conserved in other families Asn residue
  6. 2857469Protein Putative acetylxylan esterase At4g34215 [142059] (1 species)
  7. 2857470Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142060] (2 PDB entries)
    Uniprot Q8L9J9 17-260
  8. 2857473Domain d2apjc_: 2apj C: [127130]
    automated match to d2apja1

Details for d2apjc_

PDB Entry: 2apj (more details), 1.6 Å

PDB Description: x-ray structure of protein from arabidopsis thaliana at4g34215 at 1.6 angstrom resolution
PDB Compounds: (C:) Putative Esterase

SCOPe Domain Sequences for d2apjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2apjc_ c.23.10.7 (C:) Putative acetylxylan esterase At4g34215 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ppnqifilsgqsnmagrggvfkdhhnnrwvwdkilppecapnssilrlsadlrweeahep
lhvdidtgkvcgvgpgmafanavknrletdsaviglvpcasggtaikewergshlyermv
krteesrkcggeikavlwyqgesdvldihdaesygnnmdrliknlrhdlnlpslpiiqva
iasgggyidkvreaqlglklsnvvcvdakglplksdnlhltteaqvqlglslaqaylsnf
c

SCOPe Domain Coordinates for d2apjc_:

Click to download the PDB-style file with coordinates for d2apjc_.
(The format of our PDB-style files is described here.)

Timeline for d2apjc_: