Lineage for d2apja1 (2apj A:17-260)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 692305Superfamily c.23.10: SGNH hydrolase [52266] (7 families) (S)
  5. 692366Family c.23.10.7: Putative acetylxylan esterase-like [142058] (2 proteins)
    Pfam PF03629 (DUF303); contains a characteristic zinc(less) finger-like insertion after strand 1; lacks the conserved in other families Asn residue
  6. 692375Protein Putative acetylxylan esterase At4g34215 [142059] (1 species)
  7. 692376Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142060] (1 PDB entry)
  8. 692377Domain d2apja1: 2apj A:17-260 [127128]
    complexed with seb

Details for d2apja1

PDB Entry: 2apj (more details), 1.6 Å

PDB Description: x-ray structure of protein from arabidopsis thaliana at4g34215 at 1.6 angstrom resolution
PDB Compounds: (A:) Putative Esterase

SCOP Domain Sequences for d2apja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2apja1 c.23.10.7 (A:17-260) Putative acetylxylan esterase At4g34215 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
spippnqifilsgqsnmagrggvfkdhhnnrwvwdkilppecapnssilrlsadlrweea
heplhvdidtgkvcgvgpgmafanavknrletdsaviglvpcasggtaikewergshlye
rmvkrteesrkcggeikavlwyqgesdvldihdaesygnnmdrliknlrhdlnlpslpii
qvaiasgggyidkvreaqlglklsnvvcvdakglplksdnlhltteaqvqlglslaqayl
snfc

SCOP Domain Coordinates for d2apja1:

Click to download the PDB-style file with coordinates for d2apja1.
(The format of our PDB-style files is described here.)

Timeline for d2apja1: