Lineage for d2aphb_ (2aph B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536709Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 2536710Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 2536711Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. 2536743Protein Peptidoglycan recognition protein I-alpha [111141] (1 species)
  7. 2536744Species Human (Homo sapiens) [TaxId:9606] [111142] (4 PDB entries)
    Uniprot Q96LB9 177-341
  8. 2536747Domain d2aphb_: 2aph B: [127127]
    automated match to d1sk3a_
    complexed with so4

Details for d2aphb_

PDB Entry: 2aph (more details), 2.1 Å

PDB Description: crystal structure of human pgrp-ialphac in complex with muramyl pentapeptide
PDB Compounds: (B:) Peptidoglycan recognition protein I-alpha

SCOPe Domain Sequences for d2aphb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aphb_ d.118.1.1 (B:) Peptidoglycan recognition protein I-alpha {Human (Homo sapiens) [TaxId: 9606]}
vcpniikrsawearethcpkmnlpakyviiihtagtsctvstdcqtvvrniqsfhmdtrn
fcdigyhflvgqdggvyegvgwhiqgshtygfndialgiafigyfvekppnaaaleaaqd
liqcavvegyltpnyllmghsdvvnilspgqalyniistwphfkh

SCOPe Domain Coordinates for d2aphb_:

Click to download the PDB-style file with coordinates for d2aphb_.
(The format of our PDB-style files is described here.)

Timeline for d2aphb_: