Lineage for d2apha1 (2aph A:177-341)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732422Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 732423Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (1 family) (S)
  5. 732424Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (10 proteins)
    Family 2 zinc amidase;
  6. 732440Protein Peptidoglycan recognition protein I-alpha [111141] (1 species)
  7. 732441Species Human (Homo sapiens) [TaxId:9606] [111142] (4 PDB entries)
  8. 732443Domain d2apha1: 2aph A:177-341 [127126]
    automatically matched to d1sk3a_
    complexed with amu, nh2, so4

Details for d2apha1

PDB Entry: 2aph (more details), 2.1 Å

PDB Description: crystal structure of human pgrp-ialphac in complex with muramyl pentapeptide
PDB Compounds: (A:) Peptidoglycan recognition protein I-alpha

SCOP Domain Sequences for d2apha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2apha1 d.118.1.1 (A:177-341) Peptidoglycan recognition protein I-alpha {Human (Homo sapiens) [TaxId: 9606]}
vcpniikrsawearethcpkmnlpakyviiihtagtsctvstdcqtvvrniqsfhmdtrn
fcdigyhflvgqdggvyegvgwhiqgshtygfndialgiafigyfvekppnaaaleaaqd
liqcavvegyltpnyllmghsdvvnilspgqalyniistwphfkh

SCOP Domain Coordinates for d2apha1:

Click to download the PDB-style file with coordinates for d2apha1.
(The format of our PDB-style files is described here.)

Timeline for d2apha1: