Lineage for d2apha_ (2aph A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972806Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 2972807Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 2972808Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. 2972841Protein Peptidoglycan recognition protein I-alpha [111141] (1 species)
  7. 2972842Species Human (Homo sapiens) [TaxId:9606] [111142] (4 PDB entries)
    Uniprot Q96LB9 177-341
  8. 2972844Domain d2apha_: 2aph A: [127126]
    automated match to d1sk3a_
    complexed with so4

Details for d2apha_

PDB Entry: 2aph (more details), 2.1 Å

PDB Description: crystal structure of human pgrp-ialphac in complex with muramyl pentapeptide
PDB Compounds: (A:) Peptidoglycan recognition protein I-alpha

SCOPe Domain Sequences for d2apha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2apha_ d.118.1.1 (A:) Peptidoglycan recognition protein I-alpha {Human (Homo sapiens) [TaxId: 9606]}
vcpniikrsawearethcpkmnlpakyviiihtagtsctvstdcqtvvrniqsfhmdtrn
fcdigyhflvgqdggvyegvgwhiqgshtygfndialgiafigyfvekppnaaaleaaqd
liqcavvegyltpnyllmghsdvvnilspgqalyniistwphfkh

SCOPe Domain Coordinates for d2apha_:

Click to download the PDB-style file with coordinates for d2apha_.
(The format of our PDB-style files is described here.)

Timeline for d2apha_: