Lineage for d2ap9f2 (2ap9 F:6-296)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905127Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2905128Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2905147Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (2 proteins)
  6. 2905148Protein N-acetyl-l-glutamate kinase [75298] (4 species)
  7. 2905155Species Mycobacterium tuberculosis [TaxId:1773] [142719] (1 PDB entry)
    Uniprot P0A4Y6 4-294
  8. 2905161Domain d2ap9f2: 2ap9 F:6-296 [127124]
    Other proteins in same PDB: d2ap9a2, d2ap9b3, d2ap9c3, d2ap9d3, d2ap9e3, d2ap9f3
    automated match to d2ap9a1
    complexed with mg, ni

Details for d2ap9f2

PDB Entry: 2ap9 (more details), 2.8 Å

PDB Description: crystal structure of acetylglutamate kinase from mycobacterium tuberculosis cdc1551
PDB Compounds: (F:) acetylglutamate kinase

SCOPe Domain Sequences for d2ap9f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ap9f2 c.73.1.2 (F:6-296) N-acetyl-l-glutamate kinase {Mycobacterium tuberculosis [TaxId: 1773]}
iealpthikaqvlaealpwlkqlhgkvvvvkyggnamtddtlrrafaadmaflrncgihp
vvvhgggpqitamlrrlgiegdfkggfrvttpevldvarmvlfgqvgrelvnlinahgpy
avgitgedaqlftavrrsvtvdgvatdiglvgdvdqvntaamldlvaagripvvstlapd
adgvvhninadtaaaavaealgaekllmltdidglytrwpdrdslvseidtgtlaqllpt
lelgmvpkveaclraviggvpsahiidgrvthcvlvelftdagtgtkvvrg

SCOPe Domain Coordinates for d2ap9f2:

Click to download the PDB-style file with coordinates for d2ap9f2.
(The format of our PDB-style files is described here.)

Timeline for d2ap9f2: