SCOP 1.75: Domain d2ap9e1: 2ap9 E:6-296

Lineage for d2ap9e1 (2ap9 E:6-296)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (3 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (1 protein)

6. Protein N-acetyl-l-glutamate kinase [75298] (4 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [142719] (1 PDB entry)
   Uniprot P0A4Y6 4-294

8. Domain d2ap9e1: 2ap9 E:6-296 [127123]
   automatically matched to 2AP9 A:6-296
   complexed with mg, ni; mutant

Details for d2ap9e1

PDB Entry: 2ap9, 2.8 Å

PDB Description: crystal structure of acetylglutamate kinase from mycobacterium tuberculosis cdc1551

PDB Compounds: (E:) acetylglutamate kinase

SCOP Domain Sequences for d2ap9e1:

Sequence; same for both SEQRES and ATOM records:

>d2ap9e1 c.73.1.2 (E:6-296) N-acetyl-l-glutamate kinase {Mycobacterium tuberculosis [TaxId: 1773]}
iealpthikaqvlaealpwlkqlhgkvvvvkyggnamtddtlrrafaadmaflrncgihp
vvvhgggpqitamlrrlgiegdfkggfrvttpevldvarmvlfgqvgrelvnlinahgpy
avgitgedaqlftavrrsvtvdgvatdiglvgdvdqvntaamldlvaagripvvstlapd
adgvvhninadtaaaavaealgaekllmltdidglytrwpdrdslvseidtgtlaqllpt
lelgmvpkveaclraviggvpsahiidgrvthcvlvelftdagtgtkvvrg

Timeline for d2ap9e1:

• d2ap9e1 first appeared in SCOP 1.73
  
• d2ap9e1 is called d2ap9e_ in SCOPe 2.01
  
• d2ap9e1 appears in the current release, SCOPe 2.08, called d2ap9e2