Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (2 proteins) |
Protein N-acetyl-l-glutamate kinase [75298] (4 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [142719] (1 PDB entry) Uniprot P0A4Y6 4-294 |
Domain d2ap9d2: 2ap9 D:6-296 [127122] Other proteins in same PDB: d2ap9a2, d2ap9b3, d2ap9c3, d2ap9d3, d2ap9e3, d2ap9f3 automated match to d2ap9a1 complexed with mg, ni |
PDB Entry: 2ap9 (more details), 2.8 Å
SCOPe Domain Sequences for d2ap9d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ap9d2 c.73.1.2 (D:6-296) N-acetyl-l-glutamate kinase {Mycobacterium tuberculosis [TaxId: 1773]} iealpthikaqvlaealpwlkqlhgkvvvvkyggnamtddtlrrafaadmaflrncgihp vvvhgggpqitamlrrlgiegdfkggfrvttpevldvarmvlfgqvgrelvnlinahgpy avgitgedaqlftavrrsvtvdgvatdiglvgdvdqvntaamldlvaagripvvstlapd adgvvhninadtaaaavaealgaekllmltdidglytrwpdrdslvseidtgtlaqllpt lelgmvpkveaclraviggvpsahiidgrvthcvlvelftdagtgtkvvrg
Timeline for d2ap9d2: