Lineage for d2ap9a1 (2ap9 A:6-296)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 708177Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 708178Superfamily c.73.1: Carbamate kinase-like [53633] (3 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 708189Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (1 protein)
  6. 708190Protein N-acetyl-l-glutamate kinase [75298] (4 species)
  7. 708197Species Mycobacterium tuberculosis [TaxId:1773] [142719] (1 PDB entry)
  8. 708198Domain d2ap9a1: 2ap9 A:6-296 [127119]
    complexed with mg, ni; mutant

Details for d2ap9a1

PDB Entry: 2ap9 (more details), 2.8 Å

PDB Description: Crystal structure of acetylglutamate kinase from Mycobacterium tuberculosis CDC1551
PDB Compounds: (A:) acetylglutamate kinase

SCOP Domain Sequences for d2ap9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ap9a1 c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {Mycobacterium tuberculosis [TaxId: 1773]}
iealpthikaqvlaealpwlkqlhgkvvvvkyggnamtddtlrrafaadmaflrncgihp
vvvhgggpqitamlrrlgiegdfkggfrvttpevldvarmvlfgqvgrelvnlinahgpy
avgitgedaqlftavrrsvtvdgvatdiglvgdvdqvntaamldlvaagripvvstlapd
adgvvhninadtaaaavaealgaekllmltdidglytrwpdrdslvseidtgtlaqllpt
lelgmvpkveaclraviggvpsahiidgrvthcvlvelftdagtgtkvvrg

SCOP Domain Coordinates for d2ap9a1:

Click to download the PDB-style file with coordinates for d2ap9a1.
(The format of our PDB-style files is described here.)

Timeline for d2ap9a1: