Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (17 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.13: NIPSNAP [117943] (2 proteins) Pfam PF07978 |
Protein Hypothetical protein Atu4242 [117944] (1 species) |
Species Agrobacterium tumefaciens [TaxId:358] [117945] (2 PDB entries) |
Domain d2ap6g1: 2ap6 G:1-104 [127117] automatically matched to 2AP6 A:1-104 |
PDB Entry: 2ap6 (more details), 2.5 Å
SCOP Domain Sequences for d2ap6g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ap6g1 d.58.4.13 (G:1-104) Hypothetical protein Atu4242 {Agrobacterium tumefaciens [TaxId: 358]} mfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhiwafssl ddraerrarlmadprwlsflpkirdlievaenkimkparfsplm
Timeline for d2ap6g1: