SCOP 1.73: Domain d2ap6g1: 2ap6 G:1-104

Lineage for d2ap6g1 (2ap6 G:1-104)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (17 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.13: NIPSNAP [117943] (2 proteins)
   Pfam PF07978

6. Protein Hypothetical protein Atu4242 [117944] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [117945] (2 PDB entries)

8. Domain d2ap6g1: 2ap6 G:1-104 [127117]
   automatically matched to 2AP6 A:1-104

Details for d2ap6g1

PDB Entry: 2ap6, 2.5 Å

PDB Description: X-Ray Crystal Structure of Protein Atu4242 from Agrobacterium tumefaciens. Northeast Strucutral Genomics Consortium Target AtR43.

PDB Compounds: (G:) hypothetical protein Atu4242

SCOP Domain Sequences for d2ap6g1:

Sequence; same for both SEQRES and ATOM records:

>d2ap6g1 d.58.4.13 (G:1-104) Hypothetical protein Atu4242 {Agrobacterium tumefaciens [TaxId: 358]}
mfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhiwafssl
ddraerrarlmadprwlsflpkirdlievaenkimkparfsplm

Timeline for d2ap6g1:

• d2ap6g1 is new in SCOP 1.73
  
• d2ap6g1 appears in SCOP 1.75
  
• d2ap6g1 appears in the current release, SCOPe 2.08, called d2ap6g2