Lineage for d2ap6f2 (2ap6 F:1-103)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2517142Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2517374Family d.58.4.13: NIPSNAP [117943] (2 proteins)
    Pfam PF07978
  6. 2517375Protein Hypothetical protein Atu4242 [117944] (1 species)
  7. 2517376Species Agrobacterium tumefaciens [TaxId:358] [117945] (2 PDB entries)
    Uniprot Q8U857
  8. 2517387Domain d2ap6f2: 2ap6 F:1-103 [127116]
    Other proteins in same PDB: d2ap6a2, d2ap6b3, d2ap6c3, d2ap6d3, d2ap6e3, d2ap6f3, d2ap6g3, d2ap6h3
    automated match to d1vqsa_

Details for d2ap6f2

PDB Entry: 2ap6 (more details), 2.5 Å

PDB Description: X-Ray Crystal Structure of Protein Atu4242 from Agrobacterium tumefaciens. Northeast Strucutral Genomics Consortium Target AtR43.
PDB Compounds: (F:) hypothetical protein Atu4242

SCOPe Domain Sequences for d2ap6f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ap6f2 d.58.4.13 (F:1-103) Hypothetical protein Atu4242 {Agrobacterium tumefaciens [TaxId: 358]}
mfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhiwafssl
ddraerrarlmadprwlsflpkirdlievaenkimkparfspl

SCOPe Domain Coordinates for d2ap6f2:

Click to download the PDB-style file with coordinates for d2ap6f2.
(The format of our PDB-style files is described here.)

Timeline for d2ap6f2: