SCOPe 2.07: Domain d2ap6b2: 2ap6 B:1-103

Lineage for d2ap6b2 (2ap6 B:1-103)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.13: NIPSNAP [117943] (2 proteins)
   Pfam PF07978

6. Protein Hypothetical protein Atu4242 [117944] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [117945] (2 PDB entries)
   Uniprot Q8U857

8. Domain d2ap6b2: 2ap6 B:1-103 [127112]
   Other proteins in same PDB: d2ap6a2, d2ap6b3, d2ap6c3, d2ap6d3, d2ap6e3, d2ap6f3, d2ap6g3, d2ap6h3
   automated match to d1vqsa_

Details for d2ap6b2

PDB Entry: 2ap6, 2.5 Å

PDB Description: X-Ray Crystal Structure of Protein Atu4242 from Agrobacterium tumefaciens. Northeast Strucutral Genomics Consortium Target AtR43.

PDB Compounds: (B:) hypothetical protein Atu4242

SCOPe Domain Sequences for d2ap6b2:

Sequence; same for both SEQRES and ATOM records:

>d2ap6b2 d.58.4.13 (B:1-103) Hypothetical protein Atu4242 {Agrobacterium tumefaciens [TaxId: 358]}
mfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhiwafssl
ddraerrarlmadprwlsflpkirdlievaenkimkparfspl

Timeline for d2ap6b2:

• d2ap6b2 first appeared in SCOP 1.73, called d2ap6b1
  
• d2ap6b2 appears in SCOPe 2.06
  
• d2ap6b2 appears in the current release, SCOPe 2.08