![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.13: NIPSNAP [117943] (2 proteins) Pfam PF07978 |
![]() | Protein Hypothetical protein Atu4242 [117944] (1 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [117945] (2 PDB entries) Uniprot Q8U857 |
![]() | Domain d2ap6a1: 2ap6 A:1-103 [127111] Other proteins in same PDB: d2ap6a2, d2ap6b3, d2ap6c3, d2ap6d3, d2ap6e3, d2ap6f3, d2ap6g3, d2ap6h3 |
PDB Entry: 2ap6 (more details), 2.5 Å
SCOPe Domain Sequences for d2ap6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ap6a1 d.58.4.13 (A:1-103) Hypothetical protein Atu4242 {Agrobacterium tumefaciens [TaxId: 358]} mfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhiwafssl ddraerrarlmadprwlsflpkirdlievaenkimkparfspl
Timeline for d2ap6a1: