SCOP 1.73: Domain d2ap3a1: 2ap3 A:12-196

Lineage for d2ap3a1 (2ap3 A:12-196)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.27: MW0975(SA0943)-like [140423] (1 family)
   open bundle; there is a long groove between helices 1 and 4

5. Family a.24.27.1: MW0975(SA0943)-like [140424] (1 protein)

6. Protein Hypothetical protein MW0975 (SA0943) [140425] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [140426] (1 PDB entry)

8. Domain d2ap3a1: 2ap3 A:12-196 [127110]

Details for d2ap3a1

PDB Entry: 2ap3, 1.6 Å

PDB Description: 1.6 A Crystal Structure of a Conserved Protein of Unknown Function from Staphylococcus aureus

PDB Compounds: (A:) conserved hypothetical protein

SCOP Domain Sequences for d2ap3a1:

Sequence, based on SEQRES records:

>d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]}
ttdkkeikaylkqvdkikddeepiktvgkkiaeldekkkkltedvnskdtavrgkavkdl
iknaddrlkefekeedaikkseqdfkkakshvdnidndvkrkevkqlddvlkekyklhsd
yakaykkavnsektlfkylnqndatqqgvnekskaieqnykklkevsdkytkvlnkvqke
kqdvd

Sequence, based on observed residues (ATOM records):

>d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]}
ttdkkeikaylkqvdkikddeepiktvgkkiaeldekkkkltedvnskdtavrgkavkdl
iknaddrlkefekeedaikkseqdfkkadnidndvkrkevkqlddvlkekyklhsdyaka
ykkavnsektlfkylnqndatqqgvnekskaieqnykklkevsdkytkvlnkvqkekqdv
d

Timeline for d2ap3a1:

• d2ap3a1 is new in SCOP 1.73
  
• d2ap3a1 appears in SCOP 1.75
  
• d2ap3a1 appears in the current release, SCOPe 2.08