Lineage for d2ap3a1 (2ap3 A:12-196)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700768Superfamily a.24.27: MW0975(SA0943)-like [140423] (1 family) (S)
    open bundle; there is a long groove between helices 1 and 4
    automatically mapped to Pfam PF10368
  5. 2700769Family a.24.27.1: MW0975(SA0943)-like [140424] (1 protein)
  6. 2700770Protein Hypothetical protein MW0975 (SA0943) [140425] (1 species)
  7. 2700771Species Staphylococcus aureus [TaxId:1280] [140426] (1 PDB entry)
    Uniprot Q8NX77 21-205
  8. 2700772Domain d2ap3a1: 2ap3 A:12-196 [127110]
    Other proteins in same PDB: d2ap3a2

Details for d2ap3a1

PDB Entry: 2ap3 (more details), 1.6 Å

PDB Description: 1.6 A Crystal Structure of a Conserved Protein of Unknown Function from Staphylococcus aureus
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d2ap3a1:

Sequence, based on SEQRES records: (download)

>d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]}
ttdkkeikaylkqvdkikddeepiktvgkkiaeldekkkkltedvnskdtavrgkavkdl
iknaddrlkefekeedaikkseqdfkkakshvdnidndvkrkevkqlddvlkekyklhsd
yakaykkavnsektlfkylnqndatqqgvnekskaieqnykklkevsdkytkvlnkvqke
kqdvd

Sequence, based on observed residues (ATOM records): (download)

>d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]}
ttdkkeikaylkqvdkikddeepiktvgkkiaeldekkkkltedvnskdtavrgkavkdl
iknaddrlkefekeedaikkseqdfkkadnidndvkrkevkqlddvlkekyklhsdyaka
ykkavnsektlfkylnqndatqqgvnekskaieqnykklkevsdkytkvlnkvqkekqdv
d

SCOPe Domain Coordinates for d2ap3a1:

Click to download the PDB-style file with coordinates for d2ap3a1.
(The format of our PDB-style files is described here.)

Timeline for d2ap3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ap3a2