SCOPe 2.08: Domain d2aowb_: 2aow B:

Lineage for d2aowb_ (2aow B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.19: Histamine methyltransferase [75261] (1 protein)

6. Protein Histamine methyltransferase [75262] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75263] (7 PDB entries)

8. Domain d2aowb_: 2aow B: [127105]
   automated match to d1jqda_
   complexed with tha

Details for d2aowb_

PDB Entry: 2aow, 2.97 Å

PDB Description: histamine methyltransferase (natural variant i105) complexed with the acetylcholinesterase inhibitor and altzheimer's disease drug tacrine

PDB Compounds: (B:) Histamine N-methyltransferase

SCOPe Domain Sequences for d2aowb_:

Sequence; same for both SEQRES and ATOM records:

>d2aowb_ c.66.1.19 (B:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]}
mrslfsdhgkyvesfrrflnhstehqcmqefmdkklpgiigrigdtkseikilsigggag
eidlqilskvqaqypgvcinnevvepsaeqiakykelvakisnlenvkfawhketsseyq
srmlekkelqkwdfihmiqmlyyvkdipatlkffhsllgtnakmliivvsgssgwdklwk
kygsrfpqddlcqyitsddltqmldnlglkyecydllstmdisdcfidgnengdllwdfl
tetcnfnatappdlraelgkdlqepefsakkegkvlfnntlsfiviea

Timeline for d2aowb_:

• d2aowb_ first appeared in SCOP 1.73, called d2aowb1
  
• d2aowb_ appears in SCOPe 2.07