Lineage for d2aowb_ (2aow B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893472Family c.66.1.19: Histamine methyltransferase [75261] (1 protein)
  6. 2893473Protein Histamine methyltransferase [75262] (1 species)
  7. 2893474Species Human (Homo sapiens) [TaxId:9606] [75263] (7 PDB entries)
  8. 2893486Domain d2aowb_: 2aow B: [127105]
    automated match to d1jqda_
    complexed with tha

Details for d2aowb_

PDB Entry: 2aow (more details), 2.97 Å

PDB Description: histamine methyltransferase (natural variant i105) complexed with the acetylcholinesterase inhibitor and altzheimer's disease drug tacrine
PDB Compounds: (B:) Histamine N-methyltransferase

SCOPe Domain Sequences for d2aowb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aowb_ c.66.1.19 (B:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]}
mrslfsdhgkyvesfrrflnhstehqcmqefmdkklpgiigrigdtkseikilsigggag
eidlqilskvqaqypgvcinnevvepsaeqiakykelvakisnlenvkfawhketsseyq
srmlekkelqkwdfihmiqmlyyvkdipatlkffhsllgtnakmliivvsgssgwdklwk
kygsrfpqddlcqyitsddltqmldnlglkyecydllstmdisdcfidgnengdllwdfl
tetcnfnatappdlraelgkdlqepefsakkegkvlfnntlsfiviea

SCOPe Domain Coordinates for d2aowb_:

Click to download the PDB-style file with coordinates for d2aowb_.
(The format of our PDB-style files is described here.)

Timeline for d2aowb_: