SCOPe 2.01: Domain d2aoja_: 2aoj A:

Lineage for d2aoja_ (2aoj A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (5 species)

7. Species Human immunodeficiency virus type 1 (bh5 isolate) [TaxId:11682] [186950] (7 PDB entries)

8. Domain d2aoja_: 2aoj A: [127094]
   automated match to d1fgcc_
   complexed with acy, dms, gol

Details for d2aoja_

PDB Entry: 2aoj, 1.6 Å

PDB Description: crystal structure analysis of hiv-1 protease with a substrate analog p6-pr

PDB Compounds: (A:) Pol polyprotein

SCOPe Domain Sequences for d2aoja_:

Sequence; same for both SEQRES and ATOM records:

>d2aoja_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bh5 isolate) [TaxId: 11682]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

Timeline for d2aoja_:

• d2aoja_ first appeared in SCOP 1.73, called d2aoja1
  
• d2aoja_ was called d2aoja1 in SCOP 1.75
  
• d2aoja_ appears in SCOPe 2.02
  
• d2aoja_ appears in the current release, SCOPe 2.08