SCOPe 2.07: Domain d2aoia_: 2aoi A:

Lineage for d2aoia_ (2aoi A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus type 1 (bh5 isolate) [TaxId:11682] [186950] (7 PDB entries)

8. Domain d2aoia_: 2aoi A: [127092]
   automated match to d1fgcc_
   complexed with so4

Details for d2aoia_

PDB Entry: 2aoi, 1.4 Å

PDB Description: crystal structure analysis of hiv-1 protease with a substrate analog p1-p6

PDB Compounds: (A:) Pol polyprotein

SCOPe Domain Sequences for d2aoia_:

Sequence; same for both SEQRES and ATOM records:

>d2aoia_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bh5 isolate) [TaxId: 11682]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

Timeline for d2aoia_:

• d2aoia_ first appeared in SCOP 1.73, called d2aoia1
  
• d2aoia_ appears in SCOPe 2.06
  
• d2aoia_ appears in the current release, SCOPe 2.08