| Class b: All beta proteins [48724] (176 folds) |
| Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
| Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
| Protein Human immunodeficiency virus type 1 protease [50632] (8 species) |
| Species Human immunodeficiency virus type 1 (bh5 isolate) [TaxId:11682] [186950] (7 PDB entries) |
| Domain d2aoia_: 2aoi A: [127092] automated match to d1fgcc_ complexed with so4 |
PDB Entry: 2aoi (more details), 1.4 Å
SCOPe Domain Sequences for d2aoia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aoia_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bh5 isolate) [TaxId: 11682]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
Timeline for d2aoia_: